Abstract: The invention provides peptides, portions and derivatives thereof, that are useful for reducing cell migration, and for reducing symptoms of pathological diseases that are associated with undersirable cell migration, and in particular MMP-9-induced cell migration.

Abstract: The present invention is directed to methods of using HSS1 (Hematopoietic Signal peptide-containing Secreted 1), HSM1 (Hematopoietic Signal peptide-containing Membrane domain-containing 1), or a combination thereof in the treatment of various cancers, such as brain cancers.

Abstract: This invention relates to methods of inhibiting binding between a cell expressing integrin receptors specific for one or more integrins selected from the group consisting of ?IIb?3, ?v?3, ?v?5, or ?5?1, said method comprising contacting the cell with a monomeric disintegrin or monomeric disintegrin domain which comprises a C-terminal sequence non-native to the disintegrin or disintegrin domain, said C-terminal sequence encoding a functional integrin-binding loop.

Abstract: Screening and diagnostic reagents, kits and methods for primary and/or metastatic stomach or esophageal cancer are disclosed. Compositions for and methods of imaging and treating primary and/or metastatic stomach or esophageal cancer are disclosed. Vaccines compositions and methods of for treating and preventing primary and/or metastatic stomach or esophageal cancer are disclosed.

Abstract: Methods are provided for suppressing cancer metastasis. Cancer metastasis is the most common cause of treatment failure and death in cancer patients. Tumor cell invasion and/or migration can be significantly inhibited after fibrillar proteins (rVP1, F-HSA, and F-BSA) treatment in vitro. In addition, rVP1 can significantly suppress murine and human breast cancer metastasis and human prostate and ovarian cancer metastasis in vivo while F-HSA can significantly suppress murine breast cancer metastasis. Compositions of fibrillar proteins as anti-cancer metastasis therapeutics and methods of use thereof are provided herein.

Abstract: This invention relates to methods of inhibiting binding between a cell expressing integrin receptors specific for one or more integrins selected from the group consisting of ?IIb?3, ?v?3, ?v?5, or ?5?1, said method comprising contacting the cell with a monomeric disintegrin or monomeric disintegrin domain which comprises a C-terminal sequence non-native to the disintegrin or disintegrin domain, said C-terminal sequence encoding a functional integrin-binding loop.

Abstract: The present invention discloses: (i) two novel deuterated Karenitecin® analogs, pharmaceutically-acceptable salts, and/or derivatives thereof; (ii) methods of synthesis of said novel deuterated Karenitecin® analogs, pharmaceutically-acceptable salts, and/or derivatives thereof; (iii) pharmaceutically-acceptable formulations comprising said novel deuterated Karenitecin® analogs, pharmaceutically-acceptable salts, derivatives thereof; and/or, optionally, one or more additional chemotherapeutic agents; and (iv) methods of administration of said novel deuterated Karenitecin® analogs, pharmaceutically-acceptable salts, derivatives thereof; and/or, optionally, one or more additional chemotherapeutic agents, to subjects in need thereof.

Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Abstract: The present invention is directed to conjugates that include a polypeptide capable of crossing the blood-brain barrier or entering one or more cell types attached to a transport vector, i.e., a composition capable of transporting an agent (e.g., a therapeutic agent). In certain cases, the polypeptides are directly conjugated to a lipid or polymeric vector to allow targeted application of a therapeutic agent to treat, for example, a cancer, a neurodegenerative disease, or a lysosomal storage disorder.

Abstract: The invention relates to bifunctional stapled or stiched peptides comprising a targeting domain, a linker moiety, and an effector domain, that can be used to tether, or to bring into close proximity, at least two cellular entities (e.g., proteins). Certain aspects relate to bifunctional stapled or stiched peptides that bind to an effector biomolecule through the effector domain and bind to a target biomolecule through the targeting domain. Polypeptides and/or polypeptide complexes that are tethered by the bifunctional stapled or stiched peptides of the invention, where the effector polypeptide bound to the effector domain of the bifunctional stapled or stiched peptide modifies or alters the target polypeptide bound to the targeting domain of the bifunctional peptide. Uses of the inventive bifunctional stapled or stiched peptides including methods for treatment of disease (e.g., cancer, inflammatory diseases) are also provided.

Abstract: As a substance which pharmacologically regulates the function of a cell surface functional molecule, a substance which has specificity and an activity or efficacy equal or superior to an antibody and does not require an advanced production technique and facility for application thereof to a pharmaceutical product has been demanded. The invention relates to a multimer of an extracellular domain of a cell surface functional molecule, particularly a tetramer of an extracellular domain of PD-1 or PD-L1. Further, the invention relates to an application of such a tetramer as a preventive and/or therapeutic agent for cancer, cancer metastasis, immunodeficiency, an infectious disease or the like and an application of PD-1 or PD-L1 as a testing or diagnostic agent or a research agent for such a disease.

Abstract: The present invention relates to the use of receptor-associate protein (RAP) and fragments and variants thereof to improve delivery of therapeutic compounds to the liver and provides methods to treat liver disorders and conditions, such as hepatic carcinoma, by administering RAP or RAP variants conjugated to active agents.

Abstract: The present invention relates to a polypeptide derived from a highly conserved region (HCR) I-III of an extracellular region of a CD99 and CD99 family such as CD99L2 and PBDX (or XG), which are a kind of transmembrane protein, or a fused protein thereof. The polypeptide or the fused protein thereof has an activating function of inhibiting the extravasation of white blood cells, or inhibiting the growth and/or metastasis of cancer cells. The present invention also provides a polynucleotide coding the polypeptide, a vector including same, and a transformant transformed by the vector. In addition, the present invention provides a pharmaceutical composition including the polypeptide or the fused protein thereof for preventing or treating inflammatory diseases. Further, the present invention provides a pharmaceutical composition including the polypeptide or the fused protein thereof inhibiting the growth and/or metastasis of cancer cells, i.e., a pharmaceutical composition for preventing or treating cancer.

Abstract: The present invention identified a high affinity binding sequence in collagen type III for the collagen-binding integrin I domains. Provided herein are the methods used to characterize the sequence, the peptides comprising this novel sequence and the use of the peptides in enabling cell adhesion. Also provided herein are methods to identify specific integrin inhibitors, sequences of these inhibitors and their use in inhibiting pathophysiological conditions that may arise due to integrin-collagen interaction.

Abstract: The present invention involves the use peptides comprising ubiquitin interacting motifs (UIMs) alone or in combination with other agents to treat diseases involving neovascularization, such as cancer.

Abstract: The present invention is directed to a method of identifying tissue targeting domains. In particular, the invention relates to methods for identifying a polynucleotide encoding a targeting domain which directs tumor cell localization to secondary sites, to methods of utilizing the polynucleotide and corresponding polypeptide or fragments thereof and compositions comprising the same.

Abstract: The present invention relates to methods for inhibiting proliferation and/or migration of lymphatic endothelial cells and for inhibiting lymphangiogenesis, comprising administering to a subject, or to lymphatic endothelial cells derived therefrom, an effective amount of a collagen type IV-derived NC1 domain polypeptide or a fragment, derivative or variant thereof, a polynucleotide encoding the same, or an agent capable of increasing the expression or production of the NC1 domain polypeptide. Aso provided are methods for the treatment or prevention of diseases and conditions associated with aberrant lymphatic endothelial cell activity.

Abstract: The invention is directed to methods for inhibiting growth of tumor metastases in lymph nodes, lungs and other distant organ sites comprising administering one or more VEGFR-3 antagonist(s) and optionally one or more VEGFR-2 antagonist(s).

Abstract: The invention relates to methods and compositions for inhibiting metastasis, such as by inhibiting FOXC2 expression or activity. The invention further relates to methods of prognosticating, diagnosing, and assisting in the diagnosis of metastasis in an individual, or of determining the metastatic potential of a tumor. The invention further relates to methods of identifying agents which inhibit metastasis.

Abstract: Proliferation of colorectal, gastric and esophageal cancer cells is inhibited by administering ST receptor ligand. The number of ST receptor molecules on the surface of a colorectal cell or metastasized colorectal cancer cell are increased by administering an ST receptor ligand such that ligand comes into contact with an ST receptor on the surface of the colorectal cell. Pharmaceutical compositions comprise sterile, pyrogen free ST receptor ligand and a pharmaceutically acceptable carrier or diluent. Metastasized colorectal cancer is treated or imaged by increasing the number of ST receptor molecules on the surface of a metastasized colorectal cancer cell and then administering a pharmaceutical composition containing components that target the ST receptor for delivery of a therapeutic agent or imaging agent. Methods of detecting metastasized colorectal cancer are disclosed. Methods of delivering active compounds to a colorectal cell in an individual are disclosed.

Abstract: Described is a polypeptide inhibiting the transmigration of leukocytes or the growth and/or metastasis of cancer cells, a fusion protein thereof, a polynucleotide encoding the polypeptide, a vector including the polynucleotide, and a transformant transformed with the vector. Described is also a pharmaceutical composition for the prevention or treatment of inflammatory diseases, or the inhibition of the growth and/or metastasis of cancer cells including the polypeptide or a fusion protein thereof.

Abstract: Cancer therapy comprising treatment with an mTOR inhibitor, such as a dual mTORC1/mTORC2 inhibitor, such as OSI-027, in combination with an angiogenesis inhibitor.

Abstract: Methods and pharmaceutical compositions for the treatment of cancer or acute ischemia are provided. Also provided are methods of identifying agents capable of preventing the formation of or dissociating the MSF-A-HIF-1alpha protein complex, and methods of determining the prognosis of an individual having cancer by identifying the presence or absence of such a protein complex.

Abstract: The invention relates to a combination therapy for the treatment of tumors and tumor metastases comprising the continuous administration of integrin ligands, preferably integrin antagonists, together with co-therapeutic agent or therapy forms that have synergistic efficacy when administered consecutively with said ligands, such as chemotherapeutic agents and or radiation therapy.

Abstract: Ovarian cancer is treated with conjugates of an anticancer agent and an Angiopep-2 polypeptide analog (i.e. a polypeptide comprising an ammo acid sequence at least 80% identical to Seq. ID NO:97). Such treatment includes utility in treating metastatic ovarian cancer and in treating patients who have previously exhibited resistance to standard chemotherapeutic agents. Preferred anticancer agents include taxanes while the preferred conjugate is ANG1005, a conjugate comprising three molecules of paclitaxel conjugated to the peptide Angiopep-2.

Abstract: The present invention relates to pharmaceutical compositions comprising inhibitors of Prohibitin (PHB) for the prevention or/and treatment of hyperproliferative disorders.

Abstract: The present invention provides anti-angiogenic variants of pigment epithelium derived factor (PEDF) comprising at least one altered phosphorylation site, polynucleotides encoding same and uses thereof. Particularly, the present invention provides variants of human PEDF comprising at least one amino acid substitution at serine residues (24), (114), and (227). The PEDF variants are potent anti-angiogenic factors, and thus useful in treating diseases or disorders associated with neovascularization.

Abstract: An immunomodulatory compound is administered to treat, prevent, inhibit, or reduce melanoma in a subject.

Abstract: Disclosed are compositions and methods related to new targets for cancer treatment.

Abstract: Methods and assays are disclosed for treating a subject with a disease or condition in which macrophages play a pathogenic role using agents that inhibit or down regulate Wiskott-Aldrich syndrome protein (WASP).

Abstract: The instant invention relates to novel solid materials of {[(2S,5R,8S,11S)-5-Benzyl-11-(3-guanidino-propyl)-8-isopropyl-7-methyl-3,6,9,12,15-pentaoxo-1,4,7,10,13-pentaaza-cyclopentadec-2-yl]-acetic acid}, methods for producing them, and the use of said solid materials in pharmaceuticals.

Abstract: The present invention relates to molecules interfering with the function of neuropilin-1 in the context of angiogenesis and the treatment of cancer. Molecules, polypeptides, antibodies, compositions and methods are provided that are useful for reducing, inhibiting or treating angiogenesis, the invasion of blood vessels into tumors, and/or the invasion or the metastatic potential of specific tumor cells. Additionally, a method is provided that allows identifying molecules, which interfere with the functionality of neuropilin-1. Furthermore, a method is provided that allows determining whether a naturally occurring tumor cell depends on functional neuropilin-1 for its invasiveness and/or metastatic potential.

Abstract: The present invention provides compositions and pharmaceutical formulations of IaIp derived from plasma. Also provided are methods for the manufacture of the IaIp compositions and formulations, as well as method for the treatment of diseases associated with IaIp dysfunction.

Abstract: The invention is directed to beta-defensin-derived peptides and their use in modulating the activity of hematopoietic cells and other CXCR4-expressing cells. Specifically, the invention provides compositions and methods useful in the treatment of cancer. The invention further provides compositions and methods useful for promoting mobilization and transplantation of hematopoietic stem cells and progenitor cells.

Abstract: This invention relates to methods of expressing eukaryotic proteins in prokaryotic hosts, particularly eukaryotic proteins that require formation of disulfide bridges for biological activity. Various approaches are used including fusion to thioredoxin, cytoplasmic expression of disulfide isomerases, deficiencies in thioredoxin and/or glutathione reductases, deficiencies in proteases, and the like. The method is applicable to express monomeric and dimeric forms of the eukaryotic protein with biological activity such as monomeric and dimeric forms of a disintegrin or a disintegrin domain. Included are the vectors, host cells expressing the proteins, the expressed proteins and methods of using the proteins.

Abstract: The invention relates generally to compounds which are allosteric modulators (e.g., negative and positive allosteric modulators, allosteric agonists, and ago-allosteric modulators) of the G protein coupled receptor apelin, also known as the APJ receptor. The APJ receptor compounds are derived from the intracellular loops and domains of the the APJ receptor. The invention also relates to the use of these APJ receptor compounds and pharmaceutical compositions comprising the APJ receptor compounds in the treatment of diseases and conditions associated with APJ receptor modulation, such as heart diseases (e.g., hypertension and tension and heart failure, such as congestive heart failure), cancer, diabetes, stem cell trafficking, fluid homeostasis, cell proliferation, immune function, obesity, metastatic disease, and HIV infection.

Abstract: The present invention relates to a peptide useful for the preparation of a medicament for the treatment or prevention of metastasis. Furthermore, it relates to a method of treatment or prevention of metastasis comprising administering to a subject in need thereof, a therapeutically effective amount of the peptide of the invention.

Abstract: The invention relates to a method of treatment for states related to inhibition of angiogenesis and endothelial cell proliferation comprising administering an effective amount of vimentin or its derivatives or its fragments, to a subject in need thereof. Further, the invention relates to a pharmaceutical composition and a medicament comprising vimentin, as well as the use of vimentin in the manufacture of a medicament. Hereby, angiogenesis and endothelial cell proliferation can be controlled, and therapeutic treatment for related states is provided.

Abstract: The present invention concerns the use of a multimerized form of ligands of the TNF family for the preparation of a medicament for injection into an appropriate cavity of the body, for the treatment of diseases wherein cell proliferation has to be controlled wherein the ligand of the TNF family is selected among Fas ligand, CD40L, TRAIL and APRIL.

Abstract: The site-specific expression of selectins on endothelial cells of blood vessels during angiogenesis provides an opportunity to target anti-cancer drugs to the vascular endothelium to extend the range of the therapeutic effect. This invention describes an innovative drug targeting strategy for the selective delivery of the anticancer drugs to endothelial cells by means of polymer-drug conjugates modified with a carbohydrate ligand for the vascular selectins. A model chemotherapeutic drug, doxorubicin, and the E-selectin ligand, sLex, are attached to a biocompatible polymer (HPMA). The selective binding, cellular uptake, intracellular fate, and cell cytotoxicity of the polymer-bound drug are investigated in human endothelial cells.

Abstract: The invention provides methods for treatment of tissue factor (TF) mediated or associated diseases or processes, such as cancer, by administering at least an active fragment of an Ixolaris polypeptide to a subject. The invention further includes identification of a subject in need of such treatment, and monitoring a subject for amelioration of at least one sign or symptom of the disease. The invention also features kits.

Abstract: The present invention relates to compositions, methods and kits based on the ADAM-mediated cleavage of Her-2. The present invention also relates to treatments for cancer, and in particular, breast cancer, by modulating the ADAM-mediated cleavage of Her-2. Further, the invention relates to compositions, methods and kits based on the surprising synergistic effect between inhibition of Her-2 cleavage by an ADAM and certain cytostatic (e.g., Herceptin) and cytotoxic (e.g., Taxol) compounds in, among other things, inhibiting tumor cell proliferation and inducing cell death. Additionally, the invention relates to novel variants of ADAM15, designated ADAM15 variant 1 and ADAM15 variant 2, now identified and isolated.

Abstract: The invention provides a method for inhibiting EGF receptor activity comprising contacting an EGF receptor with an immunomodulatory protein (GMI) from Ganoderma microsporum, or a recombinant thereof. Also provided is a method for treating invasion and metastasis of cancer cells, comprising administering an effective amount of an immunomodulatory protein (GMI) from Ganoderma microsporum, or a recombinant thereof, to a subject in need of such treatment.

Abstract: The present invention includes methods of treating cancer in a subject, comprising administering to the subject a therapeutically effective amount of a non-proteolytically activated thrombin receptor agonist.

Abstract: Disclosed are high density lipoprotein-nucleic acid particles, wherein the particles include (a) an apolipoprotein; (b) a nucleic acid component comprising a therapeutic nucleic acid segment; and (c) a polypeptide comprising a positively charged region, wherein the positively-charged region of the polypeptide associates with the nucleic acid component. Also disclosed are pharmaceutical compositions that include a) an apolipoprotein; (b) a nucleic acid component comprising a therapeutic nucleic acid segment; and (c) a polypeptide comprising a positively charged region. Methods that concern the particles and pharmaceutical compositions of the present invention are also set forth, as well as kits.

Abstract: The invention refers to multibasic, N-terminally modified tetrapeptide mimetics with a C-terminal P1-arginine mimetic, methods for their production and use for therapy and prophylaxis of diseases, caused by bacterial pathogens or viruses, as well as for therapy and prophylaxis of diabetes, arteriosclerosis, cancer, Alzheimer's or the onset of obesity, as well as the use of these compounds as inhibitors of the proprotein convertases which cleave behind basic P1 residues, especially for inhibition of the protease furin.

Abstract: Template-fixed peptidomimetics formula (Ia) formula (Ib) wherein Z is a template-fixed chain of 14 ?-amino and/or ?-hydroxy acid residues which, depending on their positions in the chain (counted starting from the N-terminal amino acid), are Pro, Gly, a glycolic acid residue or of certain types which, as the remaining symbols in the above formulae, are defined in the description and the claims, and salts thereof, have CXCR4 antagonizing properties and can be used for preventing HIV infections in non-infected individuals or for slowing and halting viral progression in infected patients; or where cancer is mediated or resulting from CXCR4 receptor activity; or where immunological diseases are mediated or resulting from CXCR4 receptor activity; or for treating immuno suppression; or during apheresis collections of peripheral blood stem cells and/or as agents to induce mobilization of stem cells to regulate tissue repair.

Abstract: The invention relates generally to compounds which are allosteric modulators (e.g., negative and positive allosteric modulators, allosteric agonists, and ago-allosteric modulators) of the G protein coupled receptor CXCR5. The CXCR5 receptor compounds are derived from the intracellular loops and domains of the CXCR5 receptor. The invention also relates to the use of these CXCR5 receptor compounds and pharmaceutical compositions comprising the CXCR5 receptor compounds in the treatment of diseases and conditions associated with CXCR5 receptor modulation such as autoimmune diseases including lupus, HIV and rheumatoid arthritis, Primary Sjogren's Syndrome, chronic lymphocytic leukemia, Burkitt Lymphoma, colon and breast cancer tumor metastasis, Multiple Sclerosis and compromised immune function.

Abstract: Disclosed are methods, compounds, and compositions for detection, diagnosis, prognosis, monitoring, treatment, monitoring treatment, and selecting treatment of cancer and metastasis, and for identifying compounds and compositions for such uses. For example, disclosed are methods, compounds, and compositions for detecting a risk of metastasis of cancer in a subject, treating a subject at risk of metastasis of cancer, identifying an inhibitor of HIF1?:FoxA2 function or complex formation, detecting a risk of neuroendocrine differentiation (NED)-associated cancer, determining a prognosis of a cancer, determining a treatment for a cancer, monitoring or determining the effect of treatment of a NED-associated cancer, treating NED-associated cancer, identifying an inhibitor of HIF1?:FoxA2 complex formation, detecting neuroendocrine differentiation (NED)-associated cancer, monitoring the risk of metastasis of cancer in a subject, and treating NED-associated cancer.

Abstract: The invention is directed to purified and isolated novel ULBP polypeptides, the nucleic acids encoding such polypeptides, processes for production of recombinant forms of such polypeptides, antibodies generated against these polypeptides, fragmented peptides derived from these polypeptides, and the uses of the above. ULBP polypeptide can be found on the surface of human B cell lymphomas. Mammalian forms of ULBP polypeptide in isolated or purified forms are provided. In addition, isolated nucleic acids encoding ULBP polypeptides and expression vectors comprising a cDNA encoding ULBP polypeptides are provided. The ULBP polypeptides can be isolated or synthesized and used to prepare antibodies, and in particular monoclonal antibodies, against the polypeptides. The antibodies, in turn, are useful for detecting the presence of ULBP polypeptides in human cell samples, which can be correlated with the existence of a malignant condition in a patient.