Insulin Or Derivative Utilizing Patents (Class 514/5.9)
  • Patent number: 11975049
    Abstract: The invention provides reagents, pharmaceutical compositions and methods for the treatment of prevention of disorders and diseases related to defects in trigeminal innervation of the cornea, stem cell deficiency, nonhealing epithelial wounds and particularly to diseases such as neurotrophic keratopathy.
    Type: Grant
    Filed: February 16, 2021
    Date of Patent: May 7, 2024
    Inventor: Michael C. Struck
  • Patent number: 11931466
    Abstract: Provided is a process for the production of nano- and/or microparticles containing a therapeutically active agent embedded in a polymer matrix or encapsulated by a polymer shell, and nano- and/or microparticles obtainable by the process, said process comprising the steps of: a) providing a solution of a polymer selected from polylactide, polyglycolide, and polyester copolymers comprising copolymerized units of lactic acid and/or glycolic acid in an organic solvent S1 having limited water solubility; b) providing a solution or dispersion of a therapeutically active agent in as solvent or mixture of organic solvents S2 comprising at least 50 vol.
    Type: Grant
    Filed: October 25, 2021
    Date of Patent: March 19, 2024
    Assignee: FERRING B.V.
    Inventor: Celal Albayrak
  • Patent number: 11793427
    Abstract: A medical system comprising: an analyte sensor for receiving an analyte signal corresponding to an analyte concentration of a user; a health monitor device comprising a display unit and in communication with the analyte sensor, the health monitor device comprising a processor and memory communicably coupled to the processor, the memory including instructions stored therein that, when executed by the processor, cause the processor to: receive the analyte signal from the analyte sensor; determine the analyte concentration based on the analyte signal; calculate a recommended medication dosage based on the analyte concentration; associate a current parameter type with the recommended medication dosage; associate the current parameter type to at least one corresponding stored historical parameter type associated with a historical medication dosage; and display, on the display unit, the recommended medication dosage and the historical medication dosage.
    Type: Grant
    Filed: March 20, 2020
    Date of Patent: October 24, 2023
    Assignee: Abbott Diabetes Care Inc.
    Inventors: Marc B. Taub, Nathan C. Crouther, Jai Karan
  • Patent number: 11642416
    Abstract: The present invention provides a conjugate comprising an albumin binding peptide and a cargo, compositions for directing cargos to the lymphatic system, and vaccines. The methods of the invention can be used to increase an immune response, or to treat cancer or an infectious disease.
    Type: Grant
    Filed: July 9, 2021
    Date of Patent: May 9, 2023
    Assignee: Massachusetts Institute of Technology
    Inventors: Kelly Dare Moynihan, Rebecca Lynn Holden, Darrell J. Irvine, Bradley Lether Pentelute
  • Patent number: 11413352
    Abstract: The present disclosure provides conjugates which comprise an insulin molecule conjugated via a conjugate framework to one or more separate ligands that include a first saccharide, and wherein the conjugate framework also comprises a fatty chain (e.g., a C8-30 fatty chain). In certain embodiments, a conjugate is characterized in that, when the conjugate is administered to a mammal, at least one pharmacokinetic (PK) and/or pharmacodynamic (PD) property of the conjugate is sensitive to serum concentration of a second saccharide. In certain embodiments, a conjugate is also characterized by having a protracted PK profile. Exemplary conjugates and sustained release formulations are provided in addition to methods of use and preparation.
    Type: Grant
    Filed: December 13, 2018
    Date of Patent: August 16, 2022
    Assignee: Merck, Sharp & Dohme LLC
    Inventors: Chris Moyes, Songnian Lin
  • Patent number: 11396534
    Abstract: The present invention relates to a novel insulin analog, use thereof, and a method for preparing the analog.
    Type: Grant
    Filed: September 22, 2017
    Date of Patent: July 26, 2022
    Assignees: HANMI PHARM. CO., LTD., SANOFI-AVENTIS DEUTSCHLAND GMBH
    Inventors: In Young Choi, Sung Youb Jung, Marcus Korn, Stefan Guessregen, Norbert Tennagels
  • Patent number: 11366189
    Abstract: The present disclosure provides a system for MRI. The system may obtain a plurality of echo signals relating to a subject that are excited by an MRI pulse sequence applied to the subject. The system may perform a quantitative measurement on the subject based on the plurality of echo signals. The MRI pulse sequence may include a CEST module configured to selectively excite exchangeable protons or exchangeable molecules in the subject, an RF excitation pulse applied after the CEST module configured to excite a plurality of gradient echoes, and one or more refocusing pulses applied after the RF excitation pulse. In some embodiments, the quantitative measurement may include determining various quantitative parameters including a T1, a T2, a T2*, an R2 value, an R2* value, an R2?, a B0 field, a pH value, an MWF, and an APT simultaneously.
    Type: Grant
    Filed: September 25, 2020
    Date of Patent: June 21, 2022
    Assignee: UIH AMERICA, INC.
    Inventors: Hui Liu, Qi Liu, Yichen Hu
  • Patent number: 11274137
    Abstract: A method comprising: providing aqueous insulin; titrating the aqueous insulin with a mixture of small molecule anions, e.g. D- and L-amino acid esters, small D- and L-peptide pairs, and DL lactate solution, to form an insulin/anion pair solution. Titrating may be performed until the insulin/anion pair solution becomes negative by zeta potential measurement. The insulin/anion pair solution may be dialyzed to remove excess anionic polymer using a membrane sufficient to separate the insulin/anion pairs from excess small molecule anions. The insulin/anion pair solution may be dialyzed or lyophilized to remove all of the water, forming a solid of ultra-stable insulin. The positive electrostatic charge of the aqueous insulin may be confirmed by measuring a positive zeta potential value.
    Type: Grant
    Filed: September 30, 2019
    Date of Patent: March 15, 2022
    Assignee: United States of America as represented by the Secretary of the Air Force
    Inventors: Joseph M Slocik, Rajesh R. Naik, Patrick B Dennis
  • Patent number: 11214593
    Abstract: The present invention provides a peptide of formula (I), or a pharmaceutically acceptable salt thereof, wherein the N-terminal group of the peptide is a monoradical of formula —NHR1; the C-terminal group of the peptide is a monoradical of formula —C(O)—R2; R1 is a monoradical selected from hydrogen and —C(O)—(C1-C20)alkyl; R2 is a monoradical selected from —OH and —NR3R4 radical; R3 and R4 are independently selected from hydrogen and (C1-C10)alkyl; “a” to “j” are integers from 0 to 1, provided that at least one of “a” to “j” is 1; and X1 represents any amino acid. The present invention also provides conjugates and compositions comprising the peptide of formula (I). The peptide can be used in the treatment or prevention of neoplastic diseases such as pancreatic cancer.
    Type: Grant
    Filed: October 4, 2018
    Date of Patent: January 4, 2022
    Assignee: SUIGENERIS FARMACOSMETICS, S.L.
    Inventor: Teresa Royo Bargués
  • Patent number: 11207415
    Abstract: The invention involves the coupling of compounds that can be bound by Haptocorrin (R-binder; Transcobalamin I; HC) to a target drug to improve pharmacokinetics, avoid undesirable side effects, and/or modify CNS access and localization. The pharmaceutical effect may be improved by conjugating the drug to haptocorrin binding substrate. This allows the conjugate to become bound to unsaturated haptocorrin in the blood, thereby protecting the drug from metabolism or excretion to increase protein half-life while not interfering with the efficacy of the protein drug. The conjugation may additionally prevent the drug from reaching the central nervous system or modify where the drug localizes and produces undesirable side effects such as nausea or hypophagia. Such a route also would prevent, in all case save for actual vitamin B12, binding by serum transcobalamin II (TCII), and thus not cause B12 deficiency with long term use.
    Type: Grant
    Filed: April 14, 2017
    Date of Patent: December 28, 2021
    Assignee: SYRACUSE UNIVERSITY
    Inventor: Robert Doyle
  • Patent number: 11103187
    Abstract: Embodiments provide devices, systems and methods for measuring a gastric emptying (GE) parameter (GEP). Many embodiments provide a swallowable capsule having three electrodes one covered by a coating which remains in the stomach but is degraded in the small intestine (SI). The electrodes are coupled to circuitry such that when the capsule is in the stomach, current flow occurs between the first two electrodes generating a first signal and in the SI current flow occurs between the second and now uncovered third electrode generating a second signal. These two signals can be transmitted and analyzed externally or by an internal controller to determine a GEP e.g., GE time. The patient may wear an external device configured to receive and analyze the signals to determine GE time. Embodiments of the invention may be used to diagnose gastroparesis and provide patient's information on when to eat meals or administer insulin after eating.
    Type: Grant
    Filed: June 12, 2018
    Date of Patent: August 31, 2021
    Assignee: Rani Therapeutics, LLC
    Inventor: Mir A. Imran
  • Patent number: 11098102
    Abstract: The present invention relates to a conjugate comprising a sulfonamide of formula (I) and an active pharmaceutical ingredient such as an insulin analog comprising at least one mutation relative to the parent insulin, wherein the insulin analog comprises a mutation at position B16 which is substituted with a hydrophobic amino acid and/or a mutation at position B25 which is substituted with a hydrophobic amino acid. The present invention further relates to a sulfonamide of formula (A). Moreover, the present invention relates to an insulin analog comprising at least one mutation relative to the parent insulin.
    Type: Grant
    Filed: December 10, 2019
    Date of Patent: August 24, 2021
    Assignee: SANOFI
    Inventors: Maria Mendez Perez, Nils Rackelmann, Laurent Bialy, Stefan Guessregen, Martin Will, Thomas Boehme, Ana Villar Garea, Marcus Hermann Korn, Melissa Besenius, Jens Riedel, Ulrich Werner, Michael Podeschwa
  • Patent number: 11090364
    Abstract: The invention describes novel conjugates of formula (I) of a pharmaceutical agent and a moiety capable of binding to a glucose sensing protein allowing a reversible release of the pharmaceutical agent depending on the glucose concentration.
    Type: Grant
    Filed: June 2, 2017
    Date of Patent: August 17, 2021
    Assignee: Sanofi
    Inventors: Stefan Petry, Oliver Plettenburg, Norbert Tennagels, Ulrich Werner
  • Patent number: 11052023
    Abstract: A drug delivery device includes a capsule, a logic circuit disposed within the capsule, and an actuator connected to the logic circuit and configured to expose an interior of the capsule to an exterior of the capsule upon activation by the logic circuit.
    Type: Grant
    Filed: December 20, 2017
    Date of Patent: July 6, 2021
    Assignee: International Business Machines Corporation
    Inventors: Noel C. Codella, Jonathan H. Connell, II, Sharathchandra Pankanti, Nalini K. Ratha
  • Patent number: 11007248
    Abstract: This disclosure relates to compositions of isolated polypeptides and methods of their use for the treatment and prevention of disease or disease symptoms associated with MARCKS phosphorylation and/or dissociation from the cell membrane, including but not limited to allergic inflammation, asthma, chronic bronchitis, COPD, infection, hyper-reactivity, cystic fibrosis, ulcerative colitis, Crohn's disease, irritable bowel syndrome, rosacea, eczema, psoriasis, acne, arthritis, rheumatoid arthritis, psoriatic arthritis, and systemic lupus erythematosus.
    Type: Grant
    Filed: April 25, 2019
    Date of Patent: May 18, 2021
    Assignee: THE REGENTS OF THE UNIVERSITY OF CALIFORNIA
    Inventors: Reen Wu, Ching-Hsien Chen, Chen-Chen Lee
  • Patent number: 10980749
    Abstract: Embodiments of the invention provide swallowable devices, preparations and methods for delivering drugs and other therapeutic agents within the GI tract. Many embodiments provide a swallowable device for delivering the agents. Particular embodiments provide a swallowable device such as a capsule for delivering drugs into the intestinal wall or other GI lumen. Embodiments also provide various drug preparations that are configured to be contained within the capsule, advanced from the capsule into the intestinal wall and degrade to release the drug into the bloodstream to produce a therapeutic effect. The preparation can be operably coupled to delivery means having a first configuration where the preparation is contained in the capsule and a second configuration where the preparation is advanced out of the capsule into the intestinal wall. Embodiments of the invention are particularly useful for the delivery of drugs which are poorly absorbed, tolerated and/or degraded within the GI tract.
    Type: Grant
    Filed: August 15, 2019
    Date of Patent: April 20, 2021
    Assignee: Rani Therapeutics, LLC
    Inventor: Mir Imran
  • Patent number: 10919949
    Abstract: The present invention relates to novel insulin analogues and derivatives thereof, such as acylated insulin analogues, and their pharmaceutical use, in particular in the treatment or prevention of medical conditions relating to diabetes, obesity and cardiovascular diseases.
    Type: Grant
    Filed: August 16, 2018
    Date of Patent: February 16, 2021
    Assignee: Novo Nordisk A/S
    Inventors: Grith Skytte Olsen, Bo Falck Hansen, Lauge Schaeffer, Ingrid Pettersson, Rita Slaaby, Jakob Brandt
  • Patent number: 10918700
    Abstract: The invention provides methods of treating a subject having diabetes mellitus and/or a metabolic derangement.
    Type: Grant
    Filed: April 10, 2020
    Date of Patent: February 16, 2021
    Assignee: SDG, Inc.
    Inventor: W. Blair Geho
  • Patent number: 10918699
    Abstract: The invention provides reagents, pharmaceutical compositions and methods for the treatment of prevention of disorders and diseases related to defects in trigeminal innervation of the cornea, stem cell deficiency, nonhealing epithelial wounds and particularly to diseases such as neurotrophic keratopathy.
    Type: Grant
    Filed: March 22, 2018
    Date of Patent: February 16, 2021
    Inventor: Michael C. Struck
  • Patent number: 10857313
    Abstract: Embodiments provide aerosolization device for providing aerosolized medicament to user. The aerosolization device includes conduit, aerosol generator, fluid receiving chamber, restrictor within the conduit, and indicator mechanism. Conduit has an inner wall and a mouthpiece end for causing an inspiratory flow. Aerosol generator includes a vibratable mesh laterally offset from the inner wall. Fluid receiving chamber receives liquid medicament. At least a portion of chamber is tapered such that liquid medicament is directed onto vibratable mesh for aerosolization. Restrictor defines a plurality of apertures that provide increases in pressure differential that vary with inspiratory flow rate within conduit and provide relatively laminar flow downstream of restrictor. Indicator mechanism indicates a state of flow parameters relative to a predefined range. Aerosol generator is configured to aerosolize at least a portion of liquid medicament only when flow parameters of the inspiratory flow are within range.
    Type: Grant
    Filed: June 18, 2015
    Date of Patent: December 8, 2020
    Assignee: Aerami Therapeutics, Inc.
    Inventors: Jim Fink, Lisa Molloy, Ronan MacLoughlin, Claire Elizabeth Lillis, Michael Joseph Casey, John Matthew Mullins, Kieran James Hyland, Joseph Martin Grehan, Niall Scott Smith
  • Patent number: 10782305
    Abstract: Methods are described for measuring the amount of C peptide in a sample. More specifically, mass spectrometric methods are described for detecting and quantifying C peptide in a sample utilizing on-line extraction methods coupled with tandem mass spectrometric or high resolution/high accuracy mass spectrometric techniques.
    Type: Grant
    Filed: June 3, 2019
    Date of Patent: September 22, 2020
    Assignee: Quest Diagnostics Investments Incorporated
    Inventors: Nigel Clarke, Zhaohui Chen
  • Patent number: 10758519
    Abstract: It is intended to provide a drug, a quasi-drug, a dermatological preparation for external use, or a material to be contained to drugs, quasi-drugs, dermatological preparations for external use, food products, or the like which has an excellent UCP-1 expression-promoting action and promotes conversion of adipose to brown adipose (browning). The present invention provides a UCP-1 expression promoter comprising a PPAR? activator and a Smad3 inhibitor in combination. The present invention also provides a UCP-1 expression promoter comprising a PPAR? activator, a Smad3 inhibitor, and a ?3 adrenaline receptor activator or a TGR5 activator in combination.
    Type: Grant
    Filed: June 23, 2015
    Date of Patent: September 1, 2020
    Assignee: Kao Corporation
    Inventors: Satomi Kiuchi, Takatoshi Murase
  • Patent number: 10647753
    Abstract: An insulin analog with an improved in vitro effect compared with native insulin, a pharmaceutical composition for treating diabetes containing the insulin analog as an active ingredient, and a method for treating diabetes using the insulin analog or the pharmaceutical composition are described. A nucleic acid encoding the insulin analog, an expression vector including the nucleic acid, a transformant introduced with the expression vector, and a method of producing the insulin analog from the transformant are also described.
    Type: Grant
    Filed: May 25, 2018
    Date of Patent: May 12, 2020
    Assignee: HANMI PHARM. CO., LTD.
    Inventors: Jin Young Kim, Euh Lim Oh, Jong Soo Lee, Hyung Kyu Lim, In Young Choi, Se Chang Kwon
  • Patent number: 10584156
    Abstract: A two-chain insulin analogue contains an A chain modified by (i) a monomeric glucose-binding element at or near its N terminus and (ii) a B chain modified by at or near its C terminus by an element that reversibly binds to the monomeric glucose-binding element such that this linkage is displaceable by glucose. The monomeric glucose-binding element may be phenylboronic acid derivative (optionally halogenated). The B chain may be modified by a diol-containing element derived from a monosaccharide, disaccharide or oligosaccharide, a non-saccharide diol-containing moiety or a ?-hydroxycarboxylate-containing moiety. The analogue can be manufactured by trypsin-mediated semi-synthesis. Formulations can be at strengths U-10 to U-1000 in soluble solutions at pH 7.0-8.0 with or without zinc ions at a molar ratio of 0.0-3.0 ions per insulin analogue monomer.
    Type: Grant
    Filed: March 14, 2016
    Date of Patent: March 10, 2020
    Assignee: Case Western Reserve University
    Inventor: Michael Weiss
  • Patent number: 10398781
    Abstract: Conjugates which comprise a drug and a ligand which includes a first saccharide; wherein the conjugate is characterized in that, when the conjugate is administered to a mammal, at least one pharmacokinetic or pharmacodynamic property of the conjugate is sensitive to serum concentration of a second saccharide. Exemplary conjugates and sustained release formulations are provided in addition to methods of use and preparation.
    Type: Grant
    Filed: August 18, 2017
    Date of Patent: September 3, 2019
    Assignee: SMARTCELLS, INC.
    Inventors: Todd C. Zion, Thomas M. Lancaster
  • Patent number: 10392429
    Abstract: A single-chain insulin comprises a C-domain of 6 to 11 amino acid residues comprising at least two acidic residues at the N-terminal side of the C-domain and at least two basic residues at the C-terminal side of the C-domain peptide, a basic amino acid residue at the position corresponding to A8 of human insulin, and an acidic amino acid residue at the position corresponding to A14 of human insulin. The C-domain may contain a 2 to 4 amino acid joint region between the acidic and basic residues. Residues C1 and C2 may have a net negative charge of ?1 or ?2; and the remaining C-domain segment may culminates with two basic residues. A pharmaceutical composition comprises the single-chain insulin, formulated at a pH within the range 7.0 to 8.0, and may be formulated at a concentration of 0.6 mM to 5.0 mM and/or at a strength of U-100 to U-1000.
    Type: Grant
    Filed: October 6, 2015
    Date of Patent: August 27, 2019
    Assignee: Case Western Reserve University
    Inventor: Michael Weiss
  • Patent number: 10309972
    Abstract: Methods are described for measuring the amount of C peptide in a sample. More specifically, mass spectrometric methods are described for detecting and quantifying C peptide in a sample utilizing on-line extraction methods coupled with tandem mass spectrometric or high resolution/high accuracy mass spectrometric techniques.
    Type: Grant
    Filed: January 28, 2019
    Date of Patent: June 4, 2019
    Assignee: Quest Diagnostics Investments Incorporated
    Inventors: Nigel Clarke, Zhaohui Chen
  • Patent number: 10258573
    Abstract: A method of preparing an inhalable insulin suitable for pulmonary delivery includes: dissolving an insulin raw material in an acidic solution to form a dissolved insulin solution; titrating the dissolved insulin solution with a buffer solution to form a suspension comprising micronized insulin particles; and stabilizing the micronized insulin particles.
    Type: Grant
    Filed: July 8, 2015
    Date of Patent: April 16, 2019
    Assignee: Amphastar Pharmaceuticals, Inc.
    Inventors: Jeffrey Ding, Aili Bo, Mary Ziping Luo, Jack Yongfeng Zhang
  • Patent number: 10245241
    Abstract: A nasal irrigation solution (or composition) for pre- and post-operation sinus surgery and for use as a daily nasal cleanser. The composition, which may be in a powder form, may include lactated ringers with xylitol. This composition may be mixed with sterile water prior to nasal irrigation.
    Type: Grant
    Filed: June 1, 2016
    Date of Patent: April 2, 2019
    Inventors: Nina S Yoshpe, Ayal Willner, Rafael Akyuz
  • Patent number: 10172796
    Abstract: Novel encapsulated umirolimus and umirolimus polymer conjugate formulations having enhanced permeability and retention at tumor sites. Also provided are methods for treating cancer by administering the umirolimus formulations.
    Type: Grant
    Filed: December 2, 2013
    Date of Patent: January 8, 2019
    Assignee: Manli International Ltd.
    Inventors: Ting-Bin Yu, Shih-Horng Su
  • Patent number: 10143725
    Abstract: Methods for treating pain using a protein solution comprising two or more of IL1-ra, sTNF-R1, sTNF-RII, IGF-I, EGF, HGF, PDGF-AB, PDGF-BB, VEGF, TGF-?1, and sIL-1RII, Compositions may also contain white blood cells and platelets.
    Type: Grant
    Filed: March 15, 2013
    Date of Patent: December 4, 2018
    Inventors: Krista O'Shaughnessey, Jennifer E. Woodell-May, Joel C. Higgins, Michael D. Leach
  • Patent number: 10114021
    Abstract: The application discloses Quiescin Q6 as a new biomarker for acute heart failure. Methods for determining the quantity of Quiescin Q6 in a sample from a subject are described. The quantity of Quiescin Q6 is determined by contacting the sample with one or more binding agents capable of specifically binding to Quiescin Q6.
    Type: Grant
    Filed: August 19, 2016
    Date of Patent: October 30, 2018
    Assignee: MYCARTIS NV
    Inventor: Koen Kas
  • Patent number: 10088466
    Abstract: Methods and systems for measuring and using the oxidation-reduction potential (ORP) of a biological sample are provided. The system generally includes a test strip and a readout device for determining the ORP. The measured ORP is then used to determine characteristics relating to the fertility of the sample or the subject from which the sample was derived. Some characteristics that can be determined include the quality of a sperm sample, an oocyte or a fertilized egg. The measured ORP value can also be used to determine the specific characteristics of a spermatozoa sample, such as the morphology of the spermatozoa, the motility of the spermatozoa, the number of cells in the sample and the concentration of the cells in the sample. Knowledge of such characteristics and fertility potential can be used to identify individuals that might benefit from specific fertility treatments.
    Type: Grant
    Filed: March 22, 2017
    Date of Patent: October 2, 2018
    Assignee: Aytu BioScience, Inc.
    Inventors: Raphael Bar-Or, David Bar-Or, Leonard T. Rael, Kimberly B. Bjugstad, Ashok Agarwal, Rakesh Sharma, Sajal Gupta
  • Patent number: 10028902
    Abstract: Embodiments of the disclosure provide methods and/or compositions useful for an individual in need of treatment of a cardiac-related medical condition. In particular cases, GLP-1 is employed in a ultrasound targeted microbubble destruction (UTMD) system for delivery to cardiac tissue, thereby stimulating myocardial regeneration and, in at least some cases, reversal of cardiomyopathy.
    Type: Grant
    Filed: November 7, 2014
    Date of Patent: July 24, 2018
    Assignee: Baylor Research Institute
    Inventors: Paul A. Grayburn, Shuyuan Chen
  • Patent number: 9993555
    Abstract: The invention is a composition of human insulin or insulin analog that includes specific concentrations of citrate, chloride, in some cases including the addition of sodium chloride, zinc and, optionally, magnesium chloride and/or surfactant, and that has faster pharmacokinetic and/or pharmacodynamic action than commercial formulations of existing insulin analog products.
    Type: Grant
    Filed: December 9, 2015
    Date of Patent: June 12, 2018
    Assignee: Eli Lilly and Company
    Inventors: Michael Patrick Akers, Chi A. Nguyen, Chad D. Paavola, Virender Kumar Sarin, Nanette Elizabeth Schulte, Ranajoy Majumdar
  • Patent number: 9988428
    Abstract: Described herein are bioactive peptides that are modified at one or more positions with a PEG moiety. An example of such a PEGylated bioactive peptide is a GHRH analog that is modified at one or more positions with a PEG moiety. Also described are pharmaceutically acceptable salts thereof and pharmaceutical compositions comprising such analogs or salts thereof, as well as methods, kits and uses thereof, for example for inducing or stimulating growth hormone secretion in a subject and for diagnosing, preventing or treating GH-deficient conditions in a subject.
    Type: Grant
    Filed: April 18, 2017
    Date of Patent: June 5, 2018
    Assignee: GRIFFON PHARMACEUTICALS INC.
    Inventor: Krishna G. Peri
  • Patent number: 9968648
    Abstract: The invention relates to the use of a mixture of tetraethyleneglycol and amino sugars such as glucosamine or galactosamine to protect peptides and proteins and enhance their stability in solution.
    Type: Grant
    Filed: May 15, 2015
    Date of Patent: May 15, 2018
    Assignee: Calor ehf.
    Inventors: Sveinbjorn Gizurarson, Stefan Jon Sigurdsson
  • Patent number: 9901622
    Abstract: The present invention provides rapid-acting insulin and insulin analog formulations. The invention further provides delivery devices, particularly infusion sets, which allow for the rapid absorption of insulin and insulin analogs, as well as other active agents. Methods of using the insulin and insulin analog formulations as well as the insulin delivery devices for treating subjects with diabetes mellitus are also provided.
    Type: Grant
    Filed: January 13, 2015
    Date of Patent: February 27, 2018
    Assignee: THERMALIN DIABETES, INC.
    Inventors: Jeffrey I. Joseph, Richard William Berenson, Bruce Frank, Michael A. Weiss, Thomas Hattier, Gregory Dubé, Zhiqiang Chen
  • Patent number: 9889205
    Abstract: Insulin conjugates comprising an insulin molecule covalently attached to at least one bi-dentate linker having two arms, each arm independently attached to a ligand comprising a saccharide and wherein the saccharide for at least one ligand of the linker is fucose are disclosed. The insulin conjugates display a pharmacokinetic (PK) and/or pharmacodynamic (PD) profile that is responsive to the systemic concentrations of a saccharide such as glucose or alpha-methylmannose even when administered to a subject in need thereof in the absence of an exogenous multivalent saccharide-binding molecule such as Con A.
    Type: Grant
    Filed: June 24, 2016
    Date of Patent: February 13, 2018
    Assignee: Merck Sharp & Dohme Corp.
    Inventors: Songnian Lin, Lin Yan, Pei Huo
  • Patent number: 9861625
    Abstract: Provided herein are methods for treating cancer relating to inhibition of PI3K, as pharmaceutical compositions comprising a PI3K inhibitor and a PAK1 inhibitor.
    Type: Grant
    Filed: January 8, 2014
    Date of Patent: January 9, 2018
    Assignee: Duke University
    Inventors: Sandeep S. Dave, Katherine Walsh
  • Patent number: 9791461
    Abstract: An object of the present invention is to provide a novel examination method for a cardiovascular disease. As means for achieving the object, provided is an examination method for a cardiovascular disease, the method including the steps of: measuring a concentration of cyclophilin A protein in a human blood sample; and determining a probability of development of a cardiovascular disease based on the measured concentration of cyclophilin A protein.
    Type: Grant
    Filed: October 29, 2013
    Date of Patent: October 17, 2017
    Assignee: TOHOKU UNIVERSITY
    Inventors: Hiroaki Shimokawa, Kimio Satoh
  • Patent number: 9717689
    Abstract: Methods are provided for coating crystalline microparticles with an active agent by altering the surface properties of the microparticles in order to facilitate favorable association on the microparticle by the active agent. Types of surface properties that are altered by the disclosed methods include electrostatic properties, hydrophobic properties, and hydrogen bonding properties.
    Type: Grant
    Filed: February 5, 2016
    Date of Patent: August 1, 2017
    Assignee: MannKind Corporation
    Inventors: Keith A. Oberg, Joseph Sulner, Marshall L. Grant
  • Patent number: 9585942
    Abstract: The invention relates to an insulin analogue or its pharmaceutically acceptable salt, pharmaceutical composition with prolonged therapeutic effect, application of the insulin analogue, dosage method and method of treatment of diabetes. In more detail, the solution pertains to compounds being stable insulin analogues which are pharmaceutically active and characterized by a prolonged, flat, truly peakless course of glucose concentration vs. time during repeated administration and which do not show strong 24 hours fluctuations of glucose concentration, or the so-called “sawteeth effect”, during this time. Results of studies of compounds included in the scope of this application indicate an improvement in the effects of diabetes treatment by avoiding the hitherto occurring adverse influence of changes in glucose concentration throughout the entire day on a patient's organism, e.g.
    Type: Grant
    Filed: May 22, 2013
    Date of Patent: March 7, 2017
    Assignee: Instytut Biotechnologii i Antybiotykow
    Inventors: Piotr Borowicz, Andrzej Płucienniczak, Jerzy Mikołajczyk, Jarosław Antosik, Jacek Pstrzoch, Justyna Bernat, Diana Mikiewicz-Syguła, Monika Bogiel, Dorota Stadnik, Graźyna Płucienniczak, Boźena Tejchman-Małecka, Tadeusz Głąbski, Iwona Sokołowska, Dariusz Kurzynoga, Anna Wojtowicz-Krawiec, Marcin Zieliński, Malgorzata Kęsik-Brodacka, Natalia Łukasiewicz, Violetta Cecuda-Adamczewska, Monika Pawłowska, Tomasz Pawlukowiec, Jacek Stępniewski
  • Patent number: 9579287
    Abstract: A method of repairing tissue includes implanting into a patient a therapeutically effective amount of a pharmaceutical composition including microparticles including a biodegradable, biocompatible material having cells of interest or fragments thereof adhered to at least a portion of a surface; and at least one substance active on the cells or their environment upon implantation of the microparticles in a patient associated with the material wherein the substances is released in a controlled or extended manner.
    Type: Grant
    Filed: January 28, 2015
    Date of Patent: February 28, 2017
    Assignee: INSERM (INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE)
    Inventors: Claudia Montero-Menei, Philippe Menei, Jean-Pierre Benoit, Valérie Tatard, Marie-Claire Venier
  • Patent number: 9458218
    Abstract: The present invention provides therapeutic agents and compositions comprising elastic peptides and therapeutic proteins. Such peptides exhibit a flexible, extended conformation. In some embodiments, the therapeutic protein is a GLP-1 receptor agonist (e.g., GLP-1, exendin), insulin, or Factor VII/VIIa, including functional analogs. The present invention further provides encoding polynucleotides, as well as methods of making and using the therapeutic agents. The therapeutic agents have improvements in relation to their use as therapeutics, including, inter alia, one or more of half-life, clearance and/or persistance in the body, solubility, and bioavailability.
    Type: Grant
    Filed: March 4, 2014
    Date of Patent: October 4, 2016
    Assignee: DUKE UNIVERSITY
    Inventor: Ashutosh Chilkoti
  • Patent number: 9457063
    Abstract: Disclosed is a method for the prevention or treatment of vascular leakage-induced diseases and diabetic retinopathy, using C-peptide. Found to prevent extravacular leakage by inhibiting VEGF-induced disassembly of VE-cadherin, C-peptide can be applied to the prevention or treatment of various diabetic complications accompanied by vascular leakage.
    Type: Grant
    Filed: August 6, 2013
    Date of Patent: October 4, 2016
    Assignees: KANGWON NATIONAL UNIVERSITY UNIVERSITY-INDUSTRY COOPERATION FOUNDATION, AMOGREENTECH CO., LTD.
    Inventors: Kwon-Soo Ha, Young-Cheol Lim
  • Patent number: 9310379
    Abstract: This invention relates to crystals of whole antibodies and fragments thereof, and formulations and compositions comprising such crystals. More particularly, methods are provided for the crystallization of high concentrations of whole antibodies, and fragments thereof, in large batches, and for the preparation of stabilized whole antibody crystals for use alone, or in dry or slurry formulations or compositions. This invention also relates to methods for stabilization, storage and delivery of biologically active whole antibody crystals. The present invention further relates to methods using whole antibody crystals, antibody fragment crystals, or compositions or formulations comprising such crystals for biomedical applications, including biological delivery to humans and animals.
    Type: Grant
    Filed: September 25, 2008
    Date of Patent: April 12, 2016
    Assignee: Ajinomoto Althea, Inc.
    Inventors: Bhami Shenoy, Chandrika P. Govardhan, Mark X. Yang, Alexey L. Margolin
  • Patent number: 9283193
    Abstract: Methods are provided for coating crystalline microparticles with an active agent by altering the surface properties of the microparticles in order to facilitate favorable association on the microparticle by the active agent. Type of surface properties that are altered by the disclosed methods include by electrostatic properties, hydrophobic properties and hydrogen bonding properties.
    Type: Grant
    Filed: April 10, 2014
    Date of Patent: March 15, 2016
    Assignee: MannKind Corporation
    Inventors: Keith A. Oberg, Joseph Sulner, Marshall L. Grant
  • Patent number: 9238083
    Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
    Type: Grant
    Filed: September 29, 2010
    Date of Patent: January 19, 2016
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Patent number: 9216207
    Abstract: A method for oral administration of an active ingredient to a subject is provided whereby a plurality of bubbles containing the active ingredient t are formed in a small intestinal of the subject. The method includes administering orally to the subject an effective amount of the above-mentioned pharmaceutical composition. The pharmaceutical composition includes a drug layer and an enteric coating layer. The drug layer comprises an active ingredient, a surfactant, an acidic component and an effervescent ingredient. The active ingredient comprises a nucleic acid, a peptide or a protein. When the acidic component of the drug layer is dissolved in the small intestinal to react with the effervescent ingredient for generating carbon dioxide and the plurality of bubbles containing the active ingredient, and the active ingredient is embedded in a gap formed between an inner layer and an outer layer of an double-layer structure formed by the surfactant.
    Type: Grant
    Filed: October 14, 2014
    Date of Patent: December 22, 2015
    Assignee: NATIONAL TSING HUA UNIVERSITY
    Inventors: Hsing-Wen Sung, Er-Yuan Chuang, Po-Yen Lin